Protein coding transcript 55146

• Transcript: Ll_transcript_441064
• CDS coordinates: 923-1441 (+)
• Peptide sequence: MLGVLSACLSALAGIYTEFLMKKNNDSLYWQNVQLYTFGTIFNLARLILDDFRGGFEYGPWWQRIFNGYTITTWMVVLNLGSTGLLVSWLLKHADNIVKVYSTSMAMLLTMILSLFLFNFKPTLQLFLGIIICMMSLHMYFAPPNMLLDMPLTVKPDEERLIEVSVDRRTHS*
• ORF Type: complete

Annotations of Ll_transcript_441064

• Blastp: CMP-sialic acid transporter 1 from Arabidopsis with 75% of identity
• Blastx: CMP-sialic acid transporter 1 from Arabidopsis with 76.56% of identity
• Eggnog: membrane(COG0697)
• Kegg: Link to kegg annotations (AT5G41760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423721.1)
• Pfam: Nucleotide-sugar transporter (PF04142.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;