Transcript | Ll_transcript_441049 |
---|---|
CDS coordinates | 173-490 (+) |
Peptide sequence | MEHISMIMPLFHFLLRFLSLFLWKECQKSTLPKMTTEWKMVALYPIPSAIYLIHNNVQFATLTFVDTSTYQIMGNLKIVTTGILFRCPSIFYIKVEVKLFLFIIV* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | CMP-sialic acid transporter 1 from Arabidopsis with 79.82% of identity |
Eggnog | membrane(COG0697) |
Kegg | Link to kegg annotations (AT5G41760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020210817.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer