Protein coding transcript 55167

• Transcript: Ll_transcript_439432
• CDS coordinates: 351-752 (+)
• Peptide sequence: MREILHIQAGQCGNQIGGKFWEVVCDEHGIDQSGSYVGNSHLQLERVNVYYNEASGGRYVPRAVLMDLEPGTMDSLRSGPYGKIFRPDNFVFGQNGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGK*
• ORF Type: complete

Annotations of Ll_transcript_439432

• Blastp: Tubulin beta-1 chain from Soja with 94.7% of identity
• Blastx: Tubulin beta-1 chain from Soja with 83.51% of identity
• Eggnog: protein polymerization(COG5023)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444660.1)
• Pfam: Tubulin/FtsZ family, GTPase domain (PF00091.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;