Protein coding transcript 55168

• Transcript: Ll_transcript_439433
• CDS coordinates: 426-827 (+)
• Peptide sequence: MREILHIQAGQCGNQIGGKFWEVVCDEHGIDQSGNYVGNSHLQLERVNVYYNEASGGRYVPRAVLMDLEPGTMDSLRSGPYGKIFRPDNFVFGQNGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGK*
• ORF Type: complete

Annotations of Ll_transcript_439433

• Blastp: Tubulin beta-1 chain from Soja with 95.45% of identity
• Blastx: Tubulin beta-1 chain from Soja with 84.02% of identity
• Eggnog: protein polymerization(COG5023)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421160.1)
• Pfam: Tubulin/FtsZ family, GTPase domain (PF00091.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;