Transcript | Ll_transcript_440100 |
---|---|
CDS coordinates | 2104-2670 (+) |
Peptide sequence | MQQSYEVNSNGIEIFCKSWLPEASKPKAAVFYCHGYGDTCSFFFEGIARKLASSGYGVFAMDYPGFGLSEGLHCYIPSFDELVDDVIEHYSKIKENPEFRSLPSFLFGQSMGGAVVLKMHLKQPNAWDGAILVAPMCKIADDMVPPKWLTKILIGMASVLPKHKLVPQKDLAEAAFREPKKKDQVFVL* |
ORF Type | complete |
Blastp | Caffeoylshikimate esterase from Arabidopsis with 33.33% of identity |
---|---|
Blastx | Caffeoylshikimate esterase from Arabidopsis with 33.33% of identity |
Eggnog | alpha beta hydrolase fold(COG2267) |
Kegg | Link to kegg annotations (AT1G52760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428653.1) |
Pfam | Serine aminopeptidase, S33 (PF12146.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer