Protein coding transcript 554

• Transcript: Ll_transcript_334445
• CDS coordinates: 2-649 (+)
• Peptide sequence: LEILSFVFKPIVQNLVRTTFELSKRDLENFKKRVLSKWDEVDDDDQEEVNSKPHTVSYFVVTCAYVSTCIARAIQEAEKNEQKKFAFGFAVDCRARLEPPIPENYFWNCVNLHLVDAKSDDFAKEDGYVIVAKKIVSKIKNLGKDGVLDGVETLFSKHETRARLGIELIGVAGSSRFGVYETDFGWGRPSKVDITSVDRSLIIGMSESKDGKRWD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_334445

• Blastp: Phenolic glucoside malonyltransferase 1 from Arabidopsis with 31.43% of identity
• Blastx: Phenolic glucoside malonyltransferase 1 from Arabidopsis with 31.43% of identity
• Eggnog: transferase transferase, transferring acyl groups other than amino-acyl groups(ENOG4111A8V)
• Kegg: Link to kegg annotations (AT5G39050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418826.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;