Transcript | Ll_transcript_334445 |
---|---|
CDS coordinates | 2-649 (+) |
Peptide sequence | LEILSFVFKPIVQNLVRTTFELSKRDLENFKKRVLSKWDEVDDDDQEEVNSKPHTVSYFVVTCAYVSTCIARAIQEAEKNEQKKFAFGFAVDCRARLEPPIPENYFWNCVNLHLVDAKSDDFAKEDGYVIVAKKIVSKIKNLGKDGVLDGVETLFSKHETRARLGIELIGVAGSSRFGVYETDFGWGRPSKVDITSVDRSLIIGMSESKDGKRWD* |
ORF Type | 5prime_partial |
Blastp | Phenolic glucoside malonyltransferase 1 from Arabidopsis with 31.43% of identity |
---|---|
Blastx | Phenolic glucoside malonyltransferase 1 from Arabidopsis with 31.43% of identity |
Eggnog | transferase transferase, transferring acyl groups other than amino-acyl groups(ENOG4111A8V) |
Kegg | Link to kegg annotations (AT5G39050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418826.1) |
Pfam | Transferase family (PF02458.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer