Protein coding transcript 55414

• Transcript: Ll_transcript_439537
• CDS coordinates: 224-727 (+)
• Peptide sequence: MRGHLTEKADVFSFGVVALEVVSGRPNSDSSLEGDKIYLLEWAWNMHERNCITELVDPRLSKVNMEQVNRIVGVALLCTQTAPSLRPSMSRVVAMLTGDIEVSTVISRPGYLTEWNFNDVSSLMTDMETKESGTSNYNLSPSTTTVDSANRSPIDDSRPILHETWHQ*
• ORF Type: complete

Annotations of Ll_transcript_439537

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g56140 from Arabidopsis with 65.57% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g56140 from Arabidopsis with 67.69% of identity
• Eggnog: (E 0.0) leucine-rich repeat family protein protein kinase family protein(ENOG410XSG4)
• Kegg: Link to kegg annotations (AT1G56140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450589.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;