Protein coding transcript 55465

• Transcript: Ll_transcript_364175
• CDS coordinates: 2-586 (+)
• Peptide sequence: WSLIAGRLPGRTDNEIKNYWNTHIRRKLMSRGIDPATHRPLNDAENRVQDHEVQASAAAPNAISFASPVSAAAAAVKQEQDPSITSKSSMFGVFGEINNKDGRGTLLERCPDLNLELTISPPRLNEPEQPFKNMDRSLFFGCNLGMKNSSDYSCGDGSDIGNSTSSGKRNSGSTGYDFLGLKTDVWDYRRLKMK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_364175

• Blastp: Myb-related protein 308 from Antirrhinum with 47.34% of identity
• Blastx: Myb-related protein 308 from Antirrhinum with 46.15% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412991.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;