Transcript | Ll_transcript_362988 |
---|---|
CDS coordinates | 570-1382 (+) |
Peptide sequence | MGKPLFYEIWEKPATSCIIGICSAIWFYIQKKNIGYSHVGLSYETAIEGHYWRIITSAFSHISAIHLVFNMSALWSLGVVEQLDHMGLGVGYYLQYTFVMVVSSGMLVLAMYHLLIQRFKIEYFRRVTAVGYSCVVFGWMTILSMKQPSSNLELFGFLSLPISFVPFESLIFTSIVVPRASFIGHLSGIIVGYAIAWGLIHGMNSYWALSLMGWIALVFVWSLKKSGAVDLNFLEIESVTDPSLPVRFLASGNGRTLQMTALPNGNVDIV* |
ORF Type | complete |
Blastp | RHOMBOID-like protein 13 from Arabidopsis with 76.75% of identity |
---|---|
Blastx | RHOMBOID-like protein 13 from Arabidopsis with 76.75% of identity |
Eggnog | Rhomboid domain containing(ENOG41100KJ) |
Kegg | Link to kegg annotations (AT3G59520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413063.1) |
Pfam | Rhomboid family (PF01694.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer