Transcript | Ll_transcript_362865 |
---|---|
CDS coordinates | 260-1219 (+) |
Peptide sequence | MCNSKAKVTVGLEIATTATTTTTITAPHMARIHDRPVLQPTCNRVPTLERRNSIKKVTPKSLSPPLPSKASSLTPPVSPKLKSPRPPAIKRGSDNNGLNTSSEKIVTTPRSSIKTPTLERKKSKSFKEGSYGTGSIIEASLNYSSSLITDSPGSIAAVRREQVAFQQAQRKMKIAHYGRSKSAKFERLVVPLDPSITLTTKTAEEQKRCSFITANSDPIYIAYHDEEWGVPVHDEKMLFELLILSGAQVGSDWTSTLKKRLDFRSAFSEFDAEIVANLTDKQMMSISSEYGIDISKVRGVVDNANKILEVKKSFGSFDKY |
ORF Type | 3prime_partial |
Blastp | Probable GMP synthase [glutamine-hydrolyzing] from Helicobacter with 41.32% of identity |
---|---|
Blastx | Probable GMP synthase [glutamine-hydrolyzing] from Helicobacter with 41.32% of identity |
Eggnog | Catalyzes the synthesis of GMP from XMP (By similarity)(COG0518) |
Kegg | Link to kegg annotations (HH_1444) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443678.1) |
Pfam | Methyladenine glycosylase (PF03352.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer