Protein coding transcript 55491

• Transcript: Ll_transcript_362869
• CDS coordinates: 256-1068 (+)
• Peptide sequence: MWSSKAKVTIGLEITTTTTAIHVARINGRPVLQPTCNYVPTLERRNSIKKVTPIPQKSVLSPPSPPLLPCKTSLTPPVSPNSKSSRPQAIKGCNDNNGLNSSSEKIVTPPRNSIKGPKLERKKSKSFKEGSYGKGSIVEASLSYSSSLITDSPGSIAAVRREQVALQQAQRKMKIAHYGRSKSAKFERLVVPLHPSITLTSKTIEEEKRCSFITANSDLIYIAYHDEEWGVPVHDDKMLFELLTLCSAQVGSDWASTLKKRLDFRFDSAK*
• ORF Type: complete

Annotations of Ll_transcript_362869

• Blastp: DNA-3-methyladenine glycosylase 1 from Escherichia with 48.28% of identity
• Blastx: DNA-3-methyladenine glycosylase 1 from Escherichia with 45.59% of identity
• Eggnog: DNA-3-methyladenine glycosylase activity(COG2818)
• Kegg: Link to kegg annotations (JW3518)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455454.1)
• Pfam: Methyladenine glycosylase (PF03352.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;