Protein coding transcript 55503

• Transcript: Ll_transcript_361991
• CDS coordinates: 2-1039 (+)
• Peptide sequence: FNTLLSQTPTSVYAQPHFTSLFLYKSTFFFLLLNHSTLKPLYTYFSYLSLKLQIFSKSVSCFGKMYAETGLFFPYLQNFSPELLQLEEYCKTHKSNVSMSDLVQSSAMSEYDFAAEGDLFKAPEPIIEEPFLDLDPMTASISVMSRGDDISSQGFQSTDIDVLQKEQLLSDMLYECEKDLLEKAAIESPLSEILEIKVPSLNLDEYSIQEDKPFPDTPFPKSVSSASLSSLDWMHGAAVKPAFLDFSGIDFNSVYGMRRSFSEGDIKTLGNGNLNIVQSPRERPFLISNCTSEERQEKLSRYRNKKTKRNFGRKIKYACRKALADSQPRIRGRFAKTDESDAKRQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_361991

• Blastp: Zinc finger protein CONSTANS-LIKE 12 from Arabidopsis with 44.44% of identity
• Blastx: Zinc finger protein CONSTANS-LIKE 12 from Arabidopsis with 44.44% of identity
• Eggnog: zinc finger(ENOG410YKC1)
• Kegg: Link to kegg annotations (AT3G21880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415863.1)
• Pfam: CCT motif (PF06203.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;