Protein coding transcript 55508

• Transcript: Ll_transcript_361972
• CDS coordinates: 1-918 (+)
• Peptide sequence: IHSLPSIKSFNSEVTLTLIWSSSHLSLRFSKRVFLCFGEMYAETGLFFPYLQNFSQDLHQLEEYCKTHKTNVSLSDLVQSSAMSEYDFAAEGDLFKAPEPIIEESFMDLDPMTAAISMMSCGEGVSSRGLQSTDIDVLQKEQLLSDMLYECEKDLLEKAAIESPLSEILEIKVPVLNMDEYSIQEDKPFPDMPKSVSSVSLSSMDWMHGAAMKPTFLDFPGIDFNSDYGMRRSFSEGDIKALGNGNLNIVQSPRERPFLISNCTSEERQEKLSRYRHKKTKRNFGRKIKYACRKALADSQPRIRGR
• ORF Type: internal

Annotations of Ll_transcript_361972

• Blastp: Zinc finger protein CONSTANS-LIKE 12 from Arabidopsis with 44.64% of identity
• Blastx: Zinc finger protein CONSTANS-LIKE 12 from Arabidopsis with 44.64% of identity
• Eggnog: zinc finger(ENOG410YKC1)
• Kegg: Link to kegg annotations (AT3G21880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417613.1)
• Pfam: CCT motif (PF06203.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;