Protein coding transcript 5553

• Transcript: Ll_transcript_451915
• CDS coordinates: 1-792 (+)
• Peptide sequence: GLMEMRLKEMRGLGFEFDKFTLTPVMQVYCNARRFDEALSVYNTMQEKGWVDERVYAMLVLSFSKWGEVDKAFELVERMEGQRMGLNEKTFCVLIHGFVKEGRVDKACQLFDKMLMAGFVPDISLYDVLIGGLCRNKEGDKALSLISEMKEFGIQPDVGIVTKLLSSFSNRSMIVKLLEEITEEEDDKTVVLIYNAILNGYVDDGSTDEAYRLLQMMIQSKSSSGGEMNSFFCIKILVSPNTTSFNIVIDGLLKSDWKKALSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_451915

• Blastp: Putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial from Arabidopsis with 49.24% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At5g08310, mitochondrial from Arabidopsis with 51.8% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G08310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427774.1)
• Pfam: Pentacotripeptide-repeat region of PRORP (PF17177.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;