Protein coding transcript 5560

• Transcript: Ll_transcript_451667
• CDS coordinates: 185-757 (+)
• Peptide sequence: MVLVLALGDLHIPHRAADLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLKTLCPDLHITRGEYDEETKYPETKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFTAYKHEGGVVINPGSATGAYSSMTYDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTTTTQSAP*
• ORF Type: complete

Annotations of Ll_transcript_451667

• Blastp: Vacuolar protein sorting-associated protein 29 from Arabidopsis with 88.95% of identity
• Blastx: Vacuolar protein sorting-associated protein 29 from Arabidopsis with 88.95% of identity
• Eggnog: Phosphodiesterase, mj0936 family(COG0622)
• Kegg: Link to kegg annotations (AT3G47810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425714.1)
• Pfam: Calcineurin-like phosphoesterase superfamily domain (PF12850.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;