Transcript | Ll_transcript_451667 |
---|---|
CDS coordinates | 185-757 (+) |
Peptide sequence | MVLVLALGDLHIPHRAADLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLKTLCPDLHITRGEYDEETKYPETKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFTAYKHEGGVVINPGSATGAYSSMTYDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTTTTQSAP* |
ORF Type | complete |
Blastp | Vacuolar protein sorting-associated protein 29 from Arabidopsis with 88.95% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 29 from Arabidopsis with 88.95% of identity |
Eggnog | Phosphodiesterase, mj0936 family(COG0622) |
Kegg | Link to kegg annotations (AT3G47810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425714.1) |
Pfam | Calcineurin-like phosphoesterase superfamily domain (PF12850.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer