Protein coding transcript 55610

• Transcript: Ll_transcript_362715
• CDS coordinates: 2124-2459 (+)
• Peptide sequence: MGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFKTKVFHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPDIAHMYKTDRAKYESTARSWTQKYAMN*
• ORF Type: complete

Annotations of Ll_transcript_362715

• Blastp: Ubiquitin-conjugating enzyme E2 5B from Oryza sativa with 95.5% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 28 from Arabidopsis with 92.86% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (4328940)
• CantataDB: Link to cantataDB annotations (CNT0002933)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013466022.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;