Protein coding transcript 55611

• Transcript: Ll_transcript_362705
• CDS coordinates: 166-543 (+)
• Peptide sequence: MASKRITKELKDLQKDPPVSCSAGPVGEDIFHWQATIMGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFKTKVFHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPDIAHM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_362705

• Blastp: Ubiquitin-conjugating enzyme E2 5A from Oryza sativa with 93.65% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 5A from Oryza sativa with 93.65% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (4327162)
• CantataDB: Link to cantataDB annotations (CNT0002933)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462151.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;