Transcript | Ll_transcript_362712 |
---|---|
CDS coordinates | 1175-1510 (+) |
Peptide sequence | MGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFKTKVFHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPDIAHMYKTDRAKYESTARSWTQKYAMN* |
ORF Type | complete |
Blastp | Ubiquitin-conjugating enzyme E2 5B from Oryza sativa with 95.5% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2 28 from Arabidopsis with 92.86% of identity |
Eggnog | ubiquitin-conjugating enzyme(COG5078) |
Kegg | Link to kegg annotations (4328940) |
CantataDB | Link to cantataDB annotations (CNT0002933) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013466022.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer