Protein coding transcript 5574

• Transcript: Ll_transcript_451835
• CDS coordinates: 574-912 (+)
• Peptide sequence: MLDDIHNHWKKAEAVRIKCLGVPTLDMDNVCFHLEDKSGGKIIHHNINTLLLYRGRNYDPKNRPVIPLMLWKPYPPIYPRLVKNVIEGLTFEETKEMRNRGLNSHPLMKLSK*
• ORF Type: complete

Annotations of Ll_transcript_451835

• Blastp: CRS2-associated factor 2, mitochondrial from Arabidopsis with 83.04% of identity
• Blastx: CRS2-associated factor 2, mitochondrial from Arabidopsis with 58.85% of identity
• Eggnog: RNA splicing(ENOG410YFAK)
• Kegg: Link to kegg annotations (AT5G54890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014629767.1)
• Pfam: CRS1 / YhbY (CRM) domain (PF01985.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;