Transcript | Ll_transcript_362659 |
---|---|
CDS coordinates | 694-1071 (+) |
Peptide sequence | MAVSMLGVSEALALGQSLGVSATTLTKIFNCSSARCWSSDAYNPVPGVMEGVPSSRDYNGGFSSKLMVKDLNLAVESAKHAECKYPLTSQAQKIYSELCSGGHEGRDFSCAFRHYYSGMDQNQDH* |
ORF Type | complete |
Blastp | Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 79.86% of identity |
---|---|
Blastx | Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 81.54% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT4G20940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425626.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer