Protein coding transcript 55759

• Transcript: Ll_transcript_362661
• CDS coordinates: 694-1071 (+)
• Peptide sequence: MAVSMLGVSEALALGQSLGVSATTLTKIFNCSSARCWSSDAYNPVPGVMEGVPSSRDYNGGFSSKLMVKDLNLAVESAKHAECKYPLTSQAQKIYSELCSGGHEGRDFSCAFRHYYSGMDQNQDH*
• ORF Type: complete

Annotations of Ll_transcript_362661

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 79.86% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At4g20940 from Arabidopsis with 81.54% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G20940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425626.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;