Protein coding transcript 55762

• Transcript: Ll_transcript_362666
• CDS coordinates: 1247-1750 (+)
• Peptide sequence: MVGGSEEAFLAAKSVFFSMGKSAIYCGGAGSGSAAKICNNLAMAVSMLGVSEALALGQSLGVSATTLTKIFNCSSARCWSSDAYNPVPGVMEGVPSSRDYNGGFSSKLMVKDLNLAVESAKHAECKYPLTSQAQKIYSELCSGGHEGRDFSCAFRHYYSGMDQNQDH*
• ORF Type: complete

Annotations of Ll_transcript_362666

• Blastp: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 71.17% of identity
• Blastx: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 68.33% of identity
• Eggnog: Dehydrogenase(COG2084)
• Kegg: Link to kegg annotations (AT4G20930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425632.1)
• Pfam: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase (PF14833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;