Protein coding transcript 55772

• Transcript: Ll_transcript_362932
• CDS coordinates: 1271-1642 (+)
• Peptide sequence: MCRFLVDDVPVRSYPRKSDATFPSRPMYVYGSIWDASSWATEDGKYKADYKYQPFIGKYTNFKLQGCTNEASTSCKPPSASPSGGNGSLSTQQLAAMQWVQNNYLVYNYCHDPRRDHTLTPEC*
• ORF Type: complete

Annotations of Ll_transcript_362932

• Blastp: Probable xyloglucan endotransglucosylase/hydrolase protein 32 from Arabidopsis with 68.33% of identity
• Blastx: Xyloglucan endotransglucosylase/hydrolase protein 31 from Arabidopsis with 65.83% of identity
• Eggnog: xyloglucan endotransglucosylase hydrolase protein(ENOG410YDGS)
• Kegg: Link to kegg annotations (AT2G36870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447816.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;