Protein coding transcript 55774

• Transcript: Ll_transcript_362921
• CDS coordinates: 1193-1630 (+)
• Peptide sequence: MKFHLWFDPTQDFHNYAILWKPSEIIFFVDDVPIRRYPRKSDATYPTRPMYVYGSVWDASSWATENGKYKADYRYQPFIGRYRNFRLQGCTIQSPNYCKPPSTSPSGYGSLSPQQFAAMQWAQNNYLIYNYCHDPRRDHTLIPEC*
• ORF Type: complete

Annotations of Ll_transcript_362921

• Blastp: Xyloglucan endotransglucosylase/hydrolase protein 31 from Arabidopsis with 68.28% of identity
• Blastx: Xyloglucan endotransglucosylase/hydrolase protein 31 from Arabidopsis with 72.37% of identity
• Eggnog: xyloglucan endotransglucosylase hydrolase protein(ENOG411167N)
• Kegg: Link to kegg annotations (AT3G44990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464965.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;