Transcript | Ll_transcript_362926 |
---|---|
CDS coordinates | 177-1082 (+) |
Peptide sequence | MPSSLFSFLYMAPLFSLLSLSSIIPSSAQGPPSPGYYLTSKINTVNFDQGFRNLWGPQHQRLDQGSLTIWLDSTSGSGFKSLHSYRSGYFGAAIKLQPGYTAGVITSIYLSNNQDHPGNHDEIDIEFLGTTPGKPYVLQTNVYIRGSGDGYIIGREMKFHLWFDPTQDFHNYAILWKPSEIIFFVDDVPIRRYPRKSDATYPTRPMYVYGSVWDASSWATENGKYKADYRYQPFIGRYRNFRLQGCTIQSPNYCKPPSTSPSGYGSLSPQQFAAMQWAQNNYLIYNYCHDPRRDHTLIPEC* |
ORF Type | complete |
Blastp | Probable xyloglucan endotransglucosylase/hydrolase protein 32 from Arabidopsis with 67.66% of identity |
---|---|
Blastx | Probable xyloglucan endotransglucosylase/hydrolase protein 32 from Arabidopsis with 71.22% of identity |
Eggnog | xyloglucan endotransglucosylase hydrolase protein(ENOG410YDGS) |
Kegg | Link to kegg annotations (AT2G36870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464965.1) |
Pfam | Glycosyl hydrolases family 16 (PF00722.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer