Protein coding transcript 55799

• Transcript: Ll_transcript_362938
• CDS coordinates: 679-1293 (+)
• Peptide sequence: MLLWSYFSVVFTDPGHVPSSWRPSIDEERGDADPLVESAYMGADVLSNDLSASGAQEYRRVRYCRKCNQFKPPRCHHCSVCRRCILKMDHHCIWVVNCVGALNYKYFLLFLFYTFLTTALVTLSLLPYFIAFFGDEEISGSLSNLAVSFVAFVLNLAFAISILGFLIMHISFVAANTTTIEAYETKTTPKWHYDLGWRKNYEQM*
• ORF Type: complete

Annotations of Ll_transcript_362938

• Blastp: Probable protein S-acyltransferase 14 from Arabidopsis with 72.06% of identity
• Blastx: Probable protein S-acyltransferase 14 from Arabidopsis with 71.77% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G60800)
• CantataDB: Link to cantataDB annotations (CNT0001582)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446660.1)
• Pfam: DHHC palmitoyltransferase (PF01529.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;