Transcript | Ll_transcript_334433 |
---|---|
CDS coordinates | 94-720 (+) |
Peptide sequence | MPSNAIKQRLPHEDPSTTTTMNNTRKSSGHGGGGGSSRRDKRMVMAKRGLRSLAIAVSLPLSLTLLSMYLALSLHTQPLTHDHYGAAMASTKPFWFPPSWVLHLLCPASSFLMGISAWMVWADGGFHRNPMALLLYLTQIMFTVLWDPLVFGFGTVRVGLVVCLGLLVALFGCMRVFGQVNSVAADLIKPCLAWTVFLSIVNLKLVYL* |
ORF Type | complete |
Blastp | Translocator protein homolog from Arabidopsis with 43.69% of identity |
---|---|
Blastx | Translocator protein homolog from Arabidopsis with 43.69% of identity |
Eggnog | TspO/MBR family(ENOG410YY8X) |
Kegg | Link to kegg annotations (AT2G47770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433655.1) |
Pfam | TspO/MBR family (PF03073.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer