Protein coding transcript 558

• Transcript: Ll_transcript_334433
• CDS coordinates: 94-720 (+)
• Peptide sequence: MPSNAIKQRLPHEDPSTTTTMNNTRKSSGHGGGGGSSRRDKRMVMAKRGLRSLAIAVSLPLSLTLLSMYLALSLHTQPLTHDHYGAAMASTKPFWFPPSWVLHLLCPASSFLMGISAWMVWADGGFHRNPMALLLYLTQIMFTVLWDPLVFGFGTVRVGLVVCLGLLVALFGCMRVFGQVNSVAADLIKPCLAWTVFLSIVNLKLVYL*
• ORF Type: complete

Annotations of Ll_transcript_334433

• Blastp: Translocator protein homolog from Arabidopsis with 43.69% of identity
• Blastx: Translocator protein homolog from Arabidopsis with 43.69% of identity
• Eggnog: TspO/MBR family(ENOG410YY8X)
• Kegg: Link to kegg annotations (AT2G47770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433655.1)
• Pfam: TspO/MBR family (PF03073.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;