Transcript | Ll_transcript_362210 |
---|---|
CDS coordinates | 126-701 (+) |
Peptide sequence | MSLREENEEGRDLKKPFLHTGSWYRLSNNSRYSGLLGSAHALRDSSISVFACVLIVALGPIQFGFTAGYTSPTQSAIVNDLGLSVSEFSLFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIASIPNIIGWLFISFAKDTSFLYMGRLLEGFGVGIISYTVTSKKSFMLVQDYVMSNMIILRKKITGTRIYS* |
ORF Type | complete |
Blastp | Sugar transporter ERD6-like 6 from Arabidopsis with 80.75% of identity |
---|---|
Blastx | Sugar transporter ERD6-like 6 from Arabidopsis with 80.75% of identity |
Eggnog | Transporter(ENOG410XNQK) |
Kegg | Link to kegg annotations (AT1G75220) |
CantataDB | Link to cantataDB annotations (CNT0002863) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457147.1) |
Pfam | Sugar (and other) transporter (PF00083.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer