Protein coding transcript 55857

• Transcript: Ll_transcript_362224
• CDS coordinates: 233-1099 (+)
• Peptide sequence: MAIKEALIEEHKNNLLPATKGHPWMVYFTTFVAVCGSYEFGACAGYSSPTQYGITQDLSLSLAEYSLFGSILTFGAMLGAITSGPVADFIGRKGSMRVSSAFCVAGWLVIYFSEGPVPLDIGRLATGYGMGVFSFVVPVFVAEIAPKDLRGALTTLNQFMIVAGVSVAYVIGTVLSWRALALTGLIPAAVLLLGLFLIPESPRWLAKRGREKDFEEALQILRGKDADISQEAQEIKDYITTLERFPKPNLVELFQRRYLRSLTVTMPLLCNHKMTTSYDWKLHSFPFG*
• ORF Type: complete

Annotations of Ll_transcript_362224

• Blastp: Sugar transporter ERD6-like 7 from Arabidopsis with 63.97% of identity
• Blastx: Sugar transporter ERD6-like 7 from Arabidopsis with 63.97% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT2G48020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444503.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;