Transcript | Ll_transcript_362209 |
---|---|
CDS coordinates | 233-1402 (+) |
Peptide sequence | MAIKEALIEEHKNNLLPATKGHPWMVYFTTFVAVCGSYEFGACAGYSSPTQYGITQDLSLSLAEYSLFGSILTFGAMLGAITSGPVADFIGRKGSMRVSSAFCVAGWLVIYFSEGPVPLDIGRLATGYGMGVFSFVVPVFVAEIAPKDLRGALTTLNQFMIVAGVSVAYVIGTVLSWRALALTGLIPAAVLLLGLFLIPESPRWLAKRGREKDFEEALQILRGKDADISQEAQEIKDYITTLERFPKPNLVELFQRRYLRSLTIGIGLMLCQQLGGINGVCFYTSSIFELAGFSSAIGSIVYACVQVVITGLGAVLIDKAGRKPLLLVSGSGLVMGCILTAAAFYLKVQQVSVGAVPALALTGILVYIGSFSIGMGAIPWVVMSEVLLF* |
ORF Type | complete |
Blastp | Sugar transporter ERD6-like 7 from Arabidopsis with 65.8% of identity |
---|---|
Blastx | Sugar transporter ERD6-like 7 from Arabidopsis with 65.8% of identity |
Eggnog | Transporter(ENOG410XNQK) |
Kegg | Link to kegg annotations (AT2G48020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444503.1) |
Pfam | Sugar (and other) transporter (PF00083.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer