Protein coding transcript 55877

• Transcript: Ll_transcript_362369
• CDS coordinates: 406-966 (+)
• Peptide sequence: MGARCSKFSLCWWSSNVKSNLHDLSDNDDGTKNEKDPFSGFTEYTLDQLKVATSGFSPDNIVSEHGEKAPNVVYKGILEDNKLIAVKRFNKSAWPDSRQFIEEAKAVGLLRNERLANLVGFCCEGEDKLLVAEFMPNETLSKHLFHCNFPLIDSFYLFLTYINISHAIDTGTDLMFVATVRPQCLI*
• ORF Type: complete

Annotations of Ll_transcript_362369

• Blastp: Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 58.5% of identity
• Blastx: Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 66.39% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQTV)
• Kegg: Link to kegg annotations (AT5G41260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448601.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;