Transcript | Ll_transcript_362358 |
---|---|
CDS coordinates | 1573-2289 (+) |
Peptide sequence | MQALEIIRAKNFQLLMDSGLEGHFSNDDGTELVRLASRCLQYEPRERPNAKSLVTALTPLQKETSVSSYVLMGITEGGVSPKETVSLTPFGEACSRRDLTAIHEMLDKVGYKDDEDVANELSFQMWTNQIQDTLNFKKQGDSAFHAMDFSTAIDCYTQFIDSGTMVSPTVYVRRSLCYMMNDMPQEALGDAMQAQSVFPTWPTAFYLQAAALFSLGMDNDAQESLKDGTMLETRKLRN* |
ORF Type | complete |
Blastp | Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 70.88% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 70.88% of identity |
Eggnog | serine threonine-protein kinase(ENOG410XQTV) |
Kegg | Link to kegg annotations (AT5G41260) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448601.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer