Protein coding transcript 55898

• Transcript: Ll_transcript_364352
• CDS coordinates: 81-518 (+)
• Peptide sequence: MAMKAAMAAAPRGLRRFFCTNPTSSSTFPFVPPPAAGATSARQTADPNTNLFVSGLSKRTTTERLREEFAKFGEVVHARVVTDRVSGYSKGFGFVNYATIEDAAKGIEGMDGKFLDGWVIFAEYARPRPPPGQPVDNPTPYYGGR*
• ORF Type: complete

Annotations of Ll_transcript_364352

• Blastp: Organelle RRM domain-containing protein 2, mitochondrial from Arabidopsis with 67.13% of identity
• Blastx: Organelle RRM domain-containing protein 2, mitochondrial from Arabidopsis with 71.3% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT5G54580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413203.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;