Protein coding transcript 55958

• Transcript: Ll_transcript_364288
• CDS coordinates: 198-1064 (+)
• Peptide sequence: MGGACSRNQDRGNEDNSRRVLLRRFSKSGSLRWWASSFSCPSVDIQLRKGECPSLLELCILKINQDIDKYGTFSMLPRDISQQIFNKLVFSQRLTDVSLEAFRDCALQDFYLGEYLGVNDAWMDVISSQGSSLLSLDLSGSDVTDFGLTYLKDCENLMSLNLNYCDHISDHGLEGISGLSSLTTLSFKRNDSISAQGMSTFSGLVNLAKLDLERCPGIHGGLVHLQGLTKLESLNLKWCNCVTDGDMKPLSELASLKSLEISCSKVTDFGISFLKGTVPCHVLFDVPK*
• ORF Type: complete

Annotations of Ll_transcript_364288

• Blastp: F-box/LRR-repeat protein 16 from Mus with 31.33% of identity
• Blastx: F-box/LRR-repeat protein 14 from Homo with 34.45% of identity
• Eggnog: F-box and leucine-rich repeat protein 16(ENOG410XQRM)
• Kegg: Link to kegg annotations (214931)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456694.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;