Transcript | Ll_transcript_364288 |
---|---|
CDS coordinates | 198-1064 (+) |
Peptide sequence | MGGACSRNQDRGNEDNSRRVLLRRFSKSGSLRWWASSFSCPSVDIQLRKGECPSLLELCILKINQDIDKYGTFSMLPRDISQQIFNKLVFSQRLTDVSLEAFRDCALQDFYLGEYLGVNDAWMDVISSQGSSLLSLDLSGSDVTDFGLTYLKDCENLMSLNLNYCDHISDHGLEGISGLSSLTTLSFKRNDSISAQGMSTFSGLVNLAKLDLERCPGIHGGLVHLQGLTKLESLNLKWCNCVTDGDMKPLSELASLKSLEISCSKVTDFGISFLKGTVPCHVLFDVPK* |
ORF Type | complete |
Blastp | F-box/LRR-repeat protein 16 from Mus with 31.33% of identity |
---|---|
Blastx | F-box/LRR-repeat protein 14 from Homo with 34.45% of identity |
Eggnog | F-box and leucine-rich repeat protein 16(ENOG410XQRM) |
Kegg | Link to kegg annotations (214931) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456694.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer