Transcript | Ll_transcript_361885 |
---|---|
CDS coordinates | 83-610 (+) |
Peptide sequence | MMKSILGCCKLYISESRNKSALESIESASKLFPHAPIINKFEDVVYNRVGYTLVSELHPNPAEPSSEPCHLTSAVLAMVKVAFETIDFELHSGTHPRLGVVDHICFHPLADASLDHAAGTAGCLAKDMGSSLKGKVLRFILTCLKISSPLVGVRLCTSASPDPTKWEPRDLDHPF* |
ORF Type | complete |
Blastp | Glutamate formimidoyltransferase from Streptococcus with 25.19% of identity |
---|---|
Blastx | Glutamate formimidoyltransferase from Picrophilus with 31.78% of identity |
Eggnog | Glutamate formiminotransferase(COG3643) |
Kegg | Link to kegg annotations (SPy_2083) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437031.1) |
Pfam | Formiminotransferase domain, N-terminal subdomain (PF07837.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer