Protein coding transcript 55995

• Transcript: Ll_transcript_361889
• CDS coordinates: 183-629 (+)
• Peptide sequence: MMKSILGCCKLYISESRNKSALESIESASKLFPHAPIINKFEDVVYNRVGYTLVSELHPNPAEPSSEPCHLTSAVLAMVKVAFETIDFELHSGTHPRLGVVDHICFHPLADASLDHAAGTAGCLAKDMGSSLKGSFLHASKYPLRLWG*
• ORF Type: complete

Annotations of Ll_transcript_361889

• Blastp: Glutamate formimidoyltransferase from Streptococcus with 25.19% of identity
• Blastx: Formimidoyltransferase-cyclodeaminase from Gallus with 25.91% of identity
• Eggnog: Glutamate formiminotransferase(COG3643)
• Kegg: Link to kegg annotations (SPy_2083)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437031.1)
• Pfam: Formiminotransferase domain, N-terminal subdomain (PF07837.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;