Transcript | Ll_transcript_334431 |
---|---|
CDS coordinates | 57-1301 (+) |
Peptide sequence | MLFLASPLTQHLLLPPATTLHRDFTFNNRKTLTPRRLITPCPKMSLNNNNNPNPNPTLLNSLTNLLWGKSLPPGLLVTTVRTAWNSTWHLMMSQLAPSDPSGSYSRPASKFRLSGPSTATSTNLHLYVGLPCPWAHRTLIVRALKGLEDAVPVSISSPGPDGSWEFKRANGPGSGMVRPGLDNANGCKTLKEVYRVSKTGYDGRSTVPMLWDNDSKDVVCNESYDIIEFFNSGLNGLACNPDLDLSPPHLKEKIQQWYQLIYPNVNNGVYRCGFAQSQEAYDRAVNELFSTLDKLEDHFASSRYLCGDTLTLVDVCLFTTLIRFDLVYNVLFKCTKKKIYEYANLHAYTRDIYQIPKVAATCNFTEIMDGYYKILFPLNPGSIRPLIPSSSEHETLLRPHGRESISSAIPLLVK* |
ORF Type | complete |
Blastp | Glutathionyl-hydroquinone reductase YqjG from Escherichia with 39.47% of identity |
---|---|
Blastx | Glutathionyl-hydroquinone reductase YqjG from Escherichia with 39.47% of identity |
Eggnog | glutathione Stransferase(COG0435) |
Kegg | Link to kegg annotations (JW3073) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440972.1) |
Pfam | Glutathione S-transferase, N-terminal domain (PF13409.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer