Protein coding transcript 56029

• Transcript: Ll_transcript_361924
• CDS coordinates: 576-1418 (+)
• Peptide sequence: MSLLHLNSNRFSGTVPDTFRDLTSLEELDLSNNQLSGTFPSVTLYMPSLIYLDIRFNSFSGSLPQELFNKNLDAIFVNNNQFEGEIPQNLGNSPASVINLANNKLNGNIPASFGFMGSKVKEILFLNNQLTGCIPEGVGLFTEMQVLDVSFNSLMGHVPDTLSCLQNIQVLNLAHNKLSGELSEVLCSLRSLANLTVAYNFFSGFSQQCSKLFFRNIGFDFSLNCIPGRDMQRPQPECSVIPGGSLSCIRIPTPKPLVCASLVVSTTNNTHHTSPSSSSP*
• ORF Type: complete

Annotations of Ll_transcript_361924

• Blastp: Leucine-rich repeat extensin-like protein 6 from Arabidopsis with 47.79% of identity
• Blastx: Leucine-rich repeat extensin-like protein 6 from Arabidopsis with 49.63% of identity
• Eggnog: leucine-rich repeat extensin-like protein(ENOG410Y973)
• Kegg: Link to kegg annotations (AT3G22800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436216.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;