Transcript | Ll_transcript_362629 |
---|---|
CDS coordinates | 55-633 (+) |
Peptide sequence | MKTILSSETMNIPDGVTIKVHAKVIEVEGPRGKLVRDFKHLNLDFDLITDENGNKKLKIDAWFGSRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPINASIGNDNKSIEIRNFLGEKKVRKVDMLDGVNVIRSEKVKDELVLDGNDIELVSRSCALINQKCHVKNKDIRKFLDGIYVSEKGTILEE* |
ORF Type | complete |
Blastp | 60S ribosomal protein L9 from Pisum with 92.71% of identity |
---|---|
Blastx | 60S ribosomal protein L9 from Pisum with 92.71% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001709) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431546.1) |
Pfam | Ribosomal protein L6 (PF00347.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer