Protein coding transcript 561

• Transcript: Ll_transcript_351923
• CDS coordinates: 3-632 (+)
• Peptide sequence: QKDFHCSLSIWGVEEPIYKCFLFKMSGGGEEKRKRIAIIGFATLLLVAMIVVVIMGISNETEFNDDNDDDIEDNQKHVASTMKAVKTLCYPTDYKKECEENLMPAAGNNTDPKELVKIAFNVVISKIGDKLKQTEILHELENEPRAKLALETCKQLMDLSIDEFLRSLDQIKEFDLLNVDEIFTSVKVWLSGAVTYQDTCLDGFENTTSE
• ORF Type: internal

Annotations of Ll_transcript_351923

• Blastp: Putative pectinesterase/pectinesterase inhibitor 28 from Arabidopsis with 39.55% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 21 from Arabidopsis with 42.31% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G27870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451200.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;