Protein coding transcript 56118

• Transcript: Ll_transcript_362185
• CDS coordinates: 299-1057 (+)
• Peptide sequence: MGALQFTLLLYLTLLHSCNIAAYKDVDWKKATATYTKDTEGSLITEGACGYGDLHKASYGKYSAGLSTILFSRGSTCGACFEIRCVDHILWCMLGSPTVIVTATDFCPPNYGLSVDYGGWCNFPREHFELSQVAFSEIAKRKADIVPVQYRRVKCQRSGGLKFTMSGSSHFFQVLITNVGVDGEVAAVKVKGSRTGWIPMARNWGQNWHCNINLQHQPLSFEVTISSGKTLTSYNVANANWQFGQTFEGKQF*
• ORF Type: complete

Annotations of Ll_transcript_362185

• Blastp: Expansin-A20 from Arabidopsis with 62.6% of identity
• Blastx: Expansin-A20 from Arabidopsis with 65.67% of identity
• Eggnog: plant-type cell wall organization(ENOG410YAZE)
• Kegg: Link to kegg annotations (AT4G38210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414175.1)
• Pfam: Lytic transglycolase (PF03330.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;