Protein coding transcript 56133

• Transcript: Ll_transcript_362515
• CDS coordinates: 221-799 (+)
• Peptide sequence: MTRCFPTFLFFSVICIAVISNFTSATSSNFIKSSCSTTTYPTLCVESLSIYATTIQEDPHQLVQTALSVSLNNTQSTKTFVSKCYKLRGLKPIEYAALHDCAEEISDSVDRLSKSIKELKLCAVKGEDFRWHISNVETWVSSALTDETTCGDGFGGKAVNGKIKDSIRARMVNVAQVTSNALSLINQYAKKY*
• ORF Type: complete

Annotations of Ll_transcript_362515

• Blastp: 21 kDa protein from Daucus sect. Daucus with 54.05% of identity
• Blastx: 21 kDa protein from Daucus sect. Daucus with 54.05% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440899.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;