| Transcript | Ll_transcript_362521 |
|---|---|
| CDS coordinates | 548-844 (+) |
| Peptide sequence | MGCVMSSIEEDGKIGICKERKRLIKQLVGIRGEFSDSLLVYLRALRNTGATLRQFTESDSLEIETPSNDLVGPPYPQPQLPPSPPPPPPPPPPSASAPS |
| ORF Type | 3prime_partial |
| Blastp | Nitrate regulatory gene2 protein from Arabidopsis with 33.98% of identity |
|---|---|
| Blastx | - |
| Eggnog | Protein of unknown function (DUF632)(ENOG410YACB) |
| Kegg | Link to kegg annotations (AT3G60320) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416985.1) |
| Pfam | Protein of unknown function (DUF630) (PF04783.11) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer