Transcript | Ll_transcript_364044 |
---|---|
CDS coordinates | 1576-1902 (+) |
Peptide sequence | MLLVTKRRKIGTICGHAIYAIAKSEVVSIPHATVRSKMAYSKDEKRSLVNFACNCNMSLVPLKRHKRVALRTRPSPLYIDENFVMNYGFFLFQFIMLCSESVQLEHHI* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Phosphoinositide phosphatase SAC2 from Arabidopsis with 68.46% of identity |
Eggnog | Phosphatase(COG5329) |
Kegg | Link to kegg annotations (AT3G14205) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456324.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer