| Transcript | Ll_transcript_364044 |
|---|---|
| CDS coordinates | 1576-1902 (+) |
| Peptide sequence | MLLVTKRRKIGTICGHAIYAIAKSEVVSIPHATVRSKMAYSKDEKRSLVNFACNCNMSLVPLKRHKRVALRTRPSPLYIDENFVMNYGFFLFQFIMLCSESVQLEHHI* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Phosphoinositide phosphatase SAC2 from Arabidopsis with 68.46% of identity |
| Eggnog | Phosphatase(COG5329) |
| Kegg | Link to kegg annotations (AT3G14205) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456324.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer