Transcript | Ll_transcript_333543 |
---|---|
CDS coordinates | 54-356 (+) |
Peptide sequence | MTRTLRILHSINTTTVSPPPEAVSSESDYVVILAALLCALICVVGLIAVARCAWLRRGSVTGAGANSPAQALANKGLKKKVLNSLPKFTYLDSDAGGDKRN |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | RING-H2 finger protein ATL80 from Arabidopsis with 51.61% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT1G20823) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423187.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer