| Transcript | Ll_transcript_364429 |
|---|---|
| CDS coordinates | 403-702 (+) |
| Peptide sequence | METVASIFHGKLNILVNNAGIVIPKSILDHSGDDIATIMGTNFESGYHLCQLAYPFLKASGYGSIVFISSIAGFKAIPHLSLYAASKGIFNLFSSLLIY* |
| ORF Type | complete |
| Blastp | Tropinone reductase 1 from Datura with 59.79% of identity |
|---|---|
| Blastx | Tropinone reductase homolog from Datura with 59.6% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AAA33281) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017416163.1) |
| Pfam | Enoyl-(Acyl carrier protein) reductase (PF13561.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer