| Transcript | Ll_transcript_361782 |
|---|---|
| CDS coordinates | 163-591 (+) |
| Peptide sequence | MSSLNPYAASYVPLSKKEPSRVTFGTEKGSYNHDGRNLFYSSSSASHNMPGDFQPASNSFGSSSQNAALLPDDLFTDEDHIDMDIEFLKMSFPDISVQSLRDIYILNEEDLDAAIDMLDQLEVVIYVFSLQIYSSIDHKLWN* |
| ORF Type | complete |
| Blastp | Polyadenylate-binding protein-interacting protein 6 from Arabidopsis with 35.77% of identity |
|---|---|
| Blastx | Polyadenylate-binding protein-interacting protein 6 from Arabidopsis with 35.77% of identity |
| Eggnog | NA(ENOG41114K2) |
| Kegg | Link to kegg annotations (AT5G25540) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437660.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer