Protein coding transcript 56481

• Transcript: Ll_transcript_363496
• CDS coordinates: 158-589 (+)
• Peptide sequence: MREESKKATLLLVDMESGYLTIEFFRKLPQDAEKGGNPTHSLFDRYNDAYLRRIATTVLSYVNMVCSGLRHTIPKSVVYCQVREAKRSLLDNFFTELGKKEGKQLASLLNEDPAIMQRRTNISKRLELYRSAQSEIEAVAWDK*
• ORF Type: complete

Annotations of Ll_transcript_363496

• Blastp: Dynamin-related protein 1B from Arabidopsis with 81.12% of identity
• Blastx: Dynamin-related protein 1B from Arabidopsis with 80.61% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT3G61760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454615.1)
• Pfam: Dynamin GTPase effector domain (PF02212.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;