Transcript | Ll_transcript_363499 |
---|---|
CDS coordinates | 206-1279 (+) |
Peptide sequence | MIAARRRENEYFASTPEYRHLTSRMGSVHLGKVLSKHLETVIKSRIPGLQSLISKTIIDLESELNRIGKPIAADTGGKLYVVMEICRNFDQIFKDHLDGIKPGGEKIYQVFDNQFPAALKRLQFDKHLSLDTVRKLITEADGYQPHLIAPEQGYRRLIESCLVSIRGPAEAAVDTVHGILKDLIQKSMNETVELKQYPTLRVELGSAAVESLERMREESKKATLLLVDMESGYLTIEFFRKLPQDAEKGGNPTHSLFDRYNDAYLRRIATTVLSYVNMVCGGLRHTIPKSVVYCQVREAKRSLLDHFFAELGKKEGNQLASLLNEDPAIMQRRTNLSKRLELYRSAQSDIEAVAWDK* |
ORF Type | complete |
Blastp | Dynamin-related protein 1B from Arabidopsis with 80.67% of identity |
---|---|
Blastx | Dynamin-related protein 1B from Arabidopsis with 80.83% of identity |
Eggnog | Dynamin family(COG0699) |
Kegg | Link to kegg annotations (AT3G61760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459307.1) |
Pfam | Dynamin central region (PF01031.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer