Protein coding transcript 56493

• Transcript: Ll_transcript_364058
• CDS coordinates: 3-341 (+)
• Peptide sequence: EGESFFKYNYEVMEQRWKQLRAALEANGLFTVANFPNGFCTFFNKKTENLPAFVWMKCEKDIEDCQSLLSQHKIMSRGGKHFGVSQRYVRVSLLDTDENFNLFIDRLSAMQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_364058

• Blastp: Tryptophan aminotransferase-related protein 1 from Arabidopsis with 42.34% of identity
• Blastx: Tryptophan aminotransferase-related protein 1 from Arabidopsis with 42.34% of identity
• Eggnog: tryptophan aminotransferase(ENOG41114NM)
• Kegg: Link to kegg annotations (AT1G23320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436318.1)
• Pfam: Allinase (PF04864.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;